PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016482952.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 267aa    MW: 29750.4 Da    PI: 10.6309
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016482952.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.63.3e-1486130347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
   XP_016482952.1  86 AWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 130
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.54179135IPR017930Myb domain
SuperFamilySSF466895.23E-1781136IPR009057Homeodomain-like
TIGRFAMsTIGR015576.0E-1782133IPR006447Myb domain, plants
SMARTSM007174.4E-1083133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-1185130IPR009057Homeodomain-like
CDDcd001672.31E-986131No hitNo description
PfamPF002491.9E-1186130IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MSNECGNKEH EFQEISAGEG AGRNKGFMLF GVRVMEAGNS FRKSASMNNL ALFEQQHQDS  60
NVAAGYASDD VVHPSARSRE RKRGVAWTEE EHKLFLLGLQ KVGKGDWRGI SRNFVKTRTP  120
TQVASHAQKY FLRRNNINNR RRRRSSLFDI TTHTHVQSVV KLEDKQMNQN TIEKFPMSAL  180
EQAKLSGTYE SSTNNVMIGL NKSVKPIRSI PFLPVPPSSK MSNLNLNKTY AQESDEKSPP  240
ARHSSGFQAM SGGFNGKTSG DSIISVA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00630PBMTransfer from PK17526.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2128052e-40AC212805.1 Populus trichocarpa clone POP033-J14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009778557.10.0PREDICTED: transcription factor MYB1R1-like
RefseqXP_016482952.10.0PREDICTED: transcription factor MYB1R1-like
SwissprotQ2V9B06e-42MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLK4BNB61e-104K4BNB6_SOLLC; Uncharacterized protein
STRINGSolyc04g005100.2.11e-104(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114232225
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.22e-59MYB_related family protein